GTDC1 Antibody

Name GTDC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53078
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GTDC1(glycosyltransferase-like domain containing 1) The peptide sequence was selected from the N terminal of GTDC1. Peptide sequence CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GTDC1
Conjugate Unconjugated
Supplier Page Shop

Product images