RAP1GAP Antibody
| Name | RAP1GAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53072 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAP1GAP(RAP1 GTPase activating protein) The peptide sequence was selected from the middle region of RAP1GAP. Peptide sequence IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAP1GAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAP1GAP Antibody [NBP1-53072] - Human 721_B, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14414_RAP1GAP-Antibody-Western-Blot-NBP1-53072-img0004.jpg)
Western Blot: RAP1GAP Antibody [NBP1-53072] - Human 721_B, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.
![Immunohistochemistry: RAP1GAP Antibody [NBP1-53072] - Human Hela, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14415_RAP1GAP%2520Antibody-Immunohistochemistry-NBP1-53072-img0005.jpg)
Immunohistochemistry: RAP1GAP Antibody [NBP1-53072] - Human Hela, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.
![Western Blot: RAP1GAP Antibody [NBP1-53072] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14416_RAP1GAP-Antibody-Western-Blot-NBP1-53072-img0003.jpg)
Western Blot: RAP1GAP Antibody [NBP1-53072] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.