HAO2 Antibody

Name HAO2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53164
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HAO2(hydroxyacid oxidase 2 (long chain)) The peptide sequence was selected from the N terminal of HAO2. Peptide sequence DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HAO2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.