GOLGA7 Antibody

Name GOLGA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-53153
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GOLGA7(golgi autoantigen, golgin subfamily a, 7) The peptide sequence was selected from the middle region of GOLGA7. Peptide sequence ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GOLGA7
Conjugate Unconjugated
Supplier Page Shop

Product images