CDC42EP4 Antibody
| Name | CDC42EP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53150 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CDC42EP4(CDC42 effector protein (Rho GTPase binding) 4) The peptide sequence was selected from the N terminal of CDC42EP4. Peptide sequence SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CDC42EP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CDC42EP4 Antibody [NBP1-53150] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24775_CDC42EP4-Antibody-Western-Blot-NBP1-53150-img0005.jpg)
Western Blot: CDC42EP4 Antibody [NBP1-53150] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
![Western Blot: CDC42EP4 Antibody [NBP1-53150] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24776_CDC42EP4-Antibody-Western-Blot-NBP1-53150-img0003.jpg)
Western Blot: CDC42EP4 Antibody [NBP1-53150] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
![Western Blot: CDC42EP4 Antibody [NBP1-53150] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24777_CDC42EP4-Antibody-Western-Blot-NBP1-53150-img0004.jpg)
Western Blot: CDC42EP4 Antibody [NBP1-53150] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.