COG2 Antibody

Name COG2 Antibody
Supplier Novus Biologicals
Catalog NBP1-53149
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COG2(component of oligomeric golgi complex 2) The peptide sequence was selected from the N terminal of COG2. Peptide sequence KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COG2
Conjugate Unconjugated
Supplier Page Shop

Product images