RDM1 Antibody

Name RDM1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53147
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RDM1(RAD52 motif 1) The peptide sequence was selected from the middle region of RDM1. Peptide sequence NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RDM1
Conjugate Unconjugated
Supplier Page Shop

Product images