NARG1L Antibody
| Name | NARG1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53124 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NAA16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NARG1L Antibody [NBP1-53124] - HepG2 tissue lysate at a concentration of 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24941_NARG1L-Antibody-Western-Blot-NBP1-53124-img0001.jpg)
![Immunohistochemistry-Paraffin: NARG1L Antibody [NBP1-53124] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24942_NARG1L-Antibody-Immunohistochemistry-Paraffin-NBP1-53124-img0002.jpg)