AKAP7 Antibody

Name AKAP7 Antibody
Supplier Novus Biologicals
Catalog NBP1-53116
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AKAP7(A kinase (PRKA) anchor protein 7) The peptide sequence was selected from the middle region of AKAP7. Peptide sequence MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene AKAP7
Conjugate Unconjugated
Supplier Page Shop

Product images