TRIM45 Antibody

Name TRIM45 Antibody
Supplier Novus Biologicals
Catalog NBP1-53109
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIM45(tripartite motif-containing 45) The peptide sequence was selected from the N terminal of TRIM45. Peptide sequence FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIM45
Conjugate Unconjugated
Supplier Page Shop

Product images