FTS Antibody

Name FTS Antibody
Supplier Novus Biologicals
Catalog NBP1-53106
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AKTIP(AKT interacting protein) The peptide sequence was selected from the middle region of AKTIP. Peptide sequence NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AKTIP
Conjugate Unconjugated
Supplier Page Shop

Product images