TRIML1 Antibody

Name TRIML1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54340
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to TRIML1(tripartite motif family-like 1) The peptide sequence was selected from the middle region of TRIML1. Peptide sequence DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TRIML1
Supplier Page Shop

Product images