FAM107A Antibody

Name FAM107A Antibody
Supplier Novus Biologicals
Catalog NBP1-54335
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM107A(family with sequence similarity 107, member A) The peptide sequence was selected from the middle region of FAM107A. Peptide sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene FAM107A
Conjugate Unconjugated
Supplier Page Shop

Product images