TJAP1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53200
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TJAP1(tight junction associated protein 1 (peripheral)) The peptide sequence was selected from the C terminal of TJAP1. Peptide sequence PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TJAP1
• Conjugate: Unconjugated