NAT9 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53194
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NAT9(N-acetyltransferase 9 (GCN5-related, putative)) Antibody(against the N terminal of NAT9. Peptide sequence MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: NAT9
• Conjugate: Unconjugated