RPS13 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53188
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RPS13 (ribosomal protein S13) The peptide sequence was selected from the middle region of RPS13. Peptide sequence ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RPS13
• Conjugate: Unconjugated