NMT1 Antibody

Name NMT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54379
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to NMT1(N-myristoyltransferase 1) The peptide sequence was selected from the N terminal of NMT1. Peptide sequence TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NMT1
Supplier Page Shop

Product images