Dynein light chain 2 cytoplasmic Antibody
| Name | Dynein light chain 2 cytoplasmic Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54377 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding toDynein light chain 2 cytoplasmic(dynein, light chain, LC8-type 2) The peptide sequence was selected from the N terminal of Dynein light chain 2 cytoplasmic. Peptide sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DYNLL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP1-54377] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15360_Dynein%2520light%2520chain%25202%2520cytoplasmic%2520Antibody-Western%2520Blot-NBP1-54377-img0002.jpg)
Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP1-54377] - Human Heart lysate, concentration 0.2-1 ug/ml.