MYL6 Antibody
| Name | MYL6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54376 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to MYL6(myosin, light chain 6, alkali, smooth muscle and non-muscle) The peptide sequence was selected from the N terminal of MYL6. Peptide sequence CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MYL6 |
| Supplier Page | Shop |
Product images
![Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8342_MYL6%2520Antibody-Western%2520Blot-NBP1-54376-img0001.jpg)
Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.