mediator of cell motility 1 Antibody
| Name | mediator of cell motility 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54373 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to MEMO1(mediator of cell motility 1) The peptide sequence was selected from the middle region of MEMO1. Peptide sequence AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MEMO1 |
| Supplier Page | Shop |
Product images
![Western Blot: mediator of cell motility 1 Antibody [NBP1-54373] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8343_mediator%2520of%2520cell%2520motility%25201%2520Antibody-Western%2520Blot-NBP1-54373-img0002.jpg)
Western Blot: mediator of cell motility 1 Antibody [NBP1-54373] - Human Heart lysate, concentration 0.2-1 ug/ml.