PPIL2 Antibody

Name PPIL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54366
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPIL2
Conjugate Unconjugated
Supplier Page Shop

Product images