NARF Antibody

Name NARF Antibody
Supplier Novus Biologicals
Catalog NBP1-54360
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NARF(nuclear prelamin A recognition factor) The peptide sequence was selected from the middle region of NARF. Peptide sequence FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF138
Conjugate Unconjugated
Supplier Page Shop

Product images