PSMD8 Antibody

Name PSMD8 Antibody
Supplier Novus Biologicals
Catalog NBP1-54588
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to PSMD8(proteasome (prosome, macropain) 26S subunit, non-ATPase, 8) The peptide sequence was selected from the C terminal of PSMD8. Peptide sequence DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PSMD8
Supplier Page Shop

Product images