Transglutaminase 7/TGM7 Antibody

Name Transglutaminase 7/TGM7 Antibody
Supplier Novus Biologicals
Catalog NBP1-54404
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TGM7(transglutaminase 7) The peptide sequence was selected from the C terminal of TGM7. Peptide sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TGM7
Conjugate Unconjugated
Supplier Page Shop

Product images