beta ureidopropionase Antibody

Name beta ureidopropionase Antibody
Supplier Novus Biologicals
Catalog NBP1-54393
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UPB1(ureidopropionase, beta) The peptide sequence was selected from the middle region of UPB1. Peptide sequence AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene UPB1
Conjugate Unconjugated
Supplier Page Shop

Product images