PGK2 Antibody

Name PGK2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54390
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PGK2(phosphoglycerate kinase 2) The peptide sequence was selected from the C terminal of PGK2. Peptide sequence ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PGK2
Conjugate Unconjugated
Supplier Page Shop

Product images