C21orf33 Antibody
| Name | C21orf33 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80552 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human C21orf33. Peptide sequence SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | C21orf33 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: C21orf33 Antibody [NBP1-80552] - HepG2 Cell Lysate 2.5ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24382_C21orf33-Antibody-Western-Blot-NBP1-80552-img0001.jpg)
![Immunohistochemistry-Paraffin: C21orf33 Antibody [NBP1-80552] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24383_C21orf33-Antibody-Immunohistochemistry-Paraffin-NBP1-80552-img0003.jpg)