ART4 Antibody
| Name | ART4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80507 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human ART4. Peptide sequence TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ART4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ART4 Antibody [NBP1-80507] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6925_ART4-Antibody-Western-Blot-NBP1-80507-img0003.jpg)
![Western Blot: ART4 Antibody [NBP1-80507] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6926_ART4-Antibody-Western-Blot-NBP1-80507-img0002.jpg)