UCP4 Antibody

Name UCP4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80525
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the C terminal of mouse Slc25a27 (NP_082987). Peptide sequence EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC25A27
Conjugate Unconjugated
Supplier Page Shop

Product images