POLDIP1 Antibody
| Name | POLDIP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80103 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat, Dog |
| Antigen | Synthetic peptide directed towards the N terminal of human KCTD13. Peptide sequence PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KCTD13 |
| Supplier Page | Shop |
![Western Blot: POLDIP1 Antibody [NBP1-80103] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1939_POLDIP1-Antibody-Western-Blot-NBP1-80103-img0006.jpg)
![Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP1-80103] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1940_POLDIP1-Antibody-Immunohistochemistry-Paraffin-NBP1-80103-img0005.jpg)