Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody

Name Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80057
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human CHRNA4. Peptide sequence AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHRNA4
Conjugate Unconjugated
Supplier Page Shop

Product images