ZMYM6 Antibody
| Name | ZMYM6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80053 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Dog |
| Antigen | Synthetic peptide directed towards the middle region of human ZNF258. Peptide sequence TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZMYM6 |
| Supplier Page | Shop |
Product images
![Western Blot: ZMYM6 Antibody [NBP1-80053] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8405_ZMYM6-Antibody-Western-Blot-NBP1-80053-img0004.jpg)
Western Blot: ZMYM6 Antibody [NBP1-80053] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: ZMYM6 Antibody [NBP1-80053] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8406_ZMYM6-Antibody-Immunohistochemistry-Paraffin-NBP1-80053-img0003.jpg)
Immunohistochemistry-Paraffin: ZMYM6 Antibody [NBP1-80053] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.