KIF25 Antibody
| Name | KIF25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80034 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Horse, Guinea Pig |
| Antigen | Synthetic peptide directed towards the C terminal of human KIF25. Peptide sequence VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | KIF25 |
| Supplier Page | Shop |
![Western Blot: KIF25 Antibody [NBP1-80034] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8423_KIF25%2520Antibody-Western%2520Blot-NBP1-80034-img0001.jpg)
![Immunohistochemistry-Paraffin: KIF25 Antibody [NBP1-80034] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8424_KIF25%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80034-img0002.jpg)