thymocyte selection-associated high mobility group box Antibody
| Name | thymocyte selection-associated high mobility group box Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80030 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human TOX. Peptide sequence CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TOX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: thymocyte selection-associated high mobility group box Antibody [NBP1-80030] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate TOX is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15041_thymocyte%2520selection-associated%2520high%2520mobility%2520group%2520box%2520Antibody-Western%2520Blot-NBP1-80030-img0003.jpg)
Western Blot: thymocyte selection-associated high mobility group box Antibody [NBP1-80030] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate TOX is supported by BioGPS gene expression data to be expressed in Jurkat.