RPS16 Antibody
| Name | RPS16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80026 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human RPS16. Peptide sequence LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RPS16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPS16 Antibody [NBP1-80026] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17206_RPS16%2520Antibody-Western%2520Blot-NBP1-80026-img0003.jpg)
Western Blot: RPS16 Antibody [NBP1-80026] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.