GABA-A R theta Antibody

Name GABA-A R theta Antibody
Supplier Novus Biologicals
Catalog NBP1-80078
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human GABRQ. Peptide sequence KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GABRQ
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.