Gonadotropin Inducible Transcription Repressor 1 Antibody
| Name | Gonadotropin Inducible Transcription Repressor 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80177 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptide directed towards the N terminal of human GIOT-1. Peptide sequence QHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFS. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF461 |
| Supplier Page | Shop |
Product images
![Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-80177] - Titration: 1.25ug/ml, Positive Control: Human Thymus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8446_Gonadotropin%2520Inducible%2520Transcription%2520Repressor%25201%2520Antibody-Western%2520Blot-NBP1-80177-img0003.jpg)
Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-80177] - Titration: 1.25ug/ml, Positive Control: Human Thymus.
![Immunohistochemistry-Paraffin: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-80177] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8447_Gonadotropin%2520Inducible%2520Transcription%2520Repressor%25201%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80177-img0002.jpg)
Immunohistochemistry-Paraffin: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-80177] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.