Advillin Antibody
| Name | Advillin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80312 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human AVIL. Peptide sequence: QELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AVIL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Advillin Antibody [NBP1-80312] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16599_Advillin-Antibody-Western-Blot-NBP1-80312-img0004.jpg)
Western Blot: Advillin Antibody [NBP1-80312] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.