Casein Kinase 1 gamma Antibody
| Name | Casein Kinase 1 gamma Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80262 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Csnk1g1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CSNK1G1 Antibody [NBP1-80262] - Titration: 5.0ug/ml, Positive Control: SP2/0 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17323_CSNK1G1%2520Antibody-Western%2520Blot-NBP1-80262-img0003.jpg)
Western Blot: CSNK1G1 Antibody [NBP1-80262] - Titration: 5.0ug/ml, Positive Control: SP2/0 cell lysate.