ZNF580 Antibody
| Name | ZNF580 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80333 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF580. Peptide sequence KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF580 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF580 Antibody [NBP1-80333] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24333_ZNF580%2520Antibody-Western%2520Blot-NBP1-80333-img0003.jpg)
![Immunohistochemistry-Paraffin: ZNF580 Antibody [NBP1-80333] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24334_ZNF580%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80333-img0002.jpg)