ZBTB11 Antibody

Name ZBTB11 Antibody
Supplier Novus Biologicals
Catalog NBP1-80327
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZBTB11. Peptide sequence SSEESYRAILRYLTNEREPYAPGTEGNVKRKIRKAAACYVVRGGTLYYQR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZBTB11
Conjugate Unconjugated
Supplier Page Shop

Product images