GLIS3 Antibody
| Name | GLIS3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80417 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Rabbit |
| Antigen | Synthetic peptide directed towards the C terminal of human GLIS3. Peptide sequence QASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVD. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GLIS3 |
| Supplier Page | Shop |
Product images
![Western Blot: GLIS3 Antibody [NBP1-80417] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8490_GLIS3%2520Antibody-Western%2520Blot-NBP1-80417-img0002.jpg)
Western Blot: GLIS3 Antibody [NBP1-80417] - Jurkat cell lysate, concentration 0.2-1 ug/ml.