MIER3 Antibody

Name MIER3 Antibody
Supplier Novus Biologicals
Catalog NBP1-80413
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptide directed towards the middle region of human MIER3. Peptide sequence MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MIER3
Supplier Page Shop

Product images