ZNF554 Antibody
| Name | ZNF554 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80401 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Sheep |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF554. Peptide sequence GYLPRWSQELVTFEDVSMDFSQEEWELLEPAQKNLYREVMLENYRNVVSL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF554 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF554 Antibody [NBP1-80401] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8492_ZNF554%2520Antibody-Western%2520Blot-NBP1-80401-img0002.jpg)
Western Blot: ZNF554 Antibody [NBP1-80401] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.