ZNF322A Antibody
| Name | ZNF322A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80365 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ZNF322A. Peptide sequence YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF322 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF322A Antibody [NBP1-80365] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24661_ZNF322A%2520Antibody-Western%2520Blot-NBP1-80365-img0003.jpg)
![Immunohistochemistry-Paraffin: ZNF322A Antibody [NBP1-80365] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24662_ZNF322A%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80365-img0002.jpg)