PRDM13 Antibody
| Name | PRDM13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80361 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human PRDM13. Peptide sequence SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PRDM13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PRDM13 Antibody [NBP1-80361] - Jurkat cell lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17201_PRDM13-Antibody-Western-Blot-NBP1-80361-img0002.jpg)
Western Blot: PRDM13 Antibody [NBP1-80361] - Jurkat cell lysate, concentration 1.25ug/ml.