EZFIT/ZNF71 Antibody
| Name | EZFIT/ZNF71 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80358 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF71 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EZFIT/ZNF71 Antibody [NBP1-80358] - PANC1 cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19953_EZFIT-ZNF71-Antibody-Western-Blot-NBP1-80358-img0001.jpg)
Western Blot: EZFIT/ZNF71 Antibody [NBP1-80358] - PANC1 cell lysate, concentration 1 ug/ml.
![Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human spleen after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19954_EZFIT-ZNF71-Antibody-Immunohistochemistry-NBP1-80358-img0004.jpg)
Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human spleen after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
![Immunohistochemistry-Paraffin: EZFIT/ZNF71 Antibody [NBP1-80358] - Human Placenta Tissue, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19955_EZFIT-ZNF71-Antibody-Immunohistochemistry-Paraffin-NBP1-80358-img0002.jpg)
Immunohistochemistry-Paraffin: EZFIT/ZNF71 Antibody [NBP1-80358] - Human Placenta Tissue, 5.0ug/ml.
![Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human uterus after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19956_EZFIT-ZNF71-Antibody-Immunohistochemistry-NBP1-80358-img0003.jpg)
Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human uterus after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
![Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human placenta after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19957_EZFIT-ZNF71%2520Antibody-Immunohistochemistry-NBP1-80358-img0005.jpg)
Immunohistochemistry: EZFIT/ZNF71 Antibody [NBP1-80358] - Analysis of human placenta after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.