ZBTB26 Antibody

Name ZBTB26 Antibody
Supplier Novus Biologicals
Catalog NBP1-80350
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZBTB26. Peptide sequence MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZBTB26
Conjugate Unconjugated
Supplier Page Shop

Product images