BCL6B Antibody

Name BCL6B Antibody
Supplier Novus Biologicals
Catalog NBP1-80434
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human BCL6B. Peptide sequence LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BCL6B
Conjugate Unconjugated
Supplier Page Shop

Product images