ZNF488 Antibody

Name ZNF488 Antibody
Supplier Novus Biologicals
Catalog NBP1-80422
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human ZNF488. Peptide sequence VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZNF488
Conjugate Unconjugated
Supplier Page Shop

Product images